PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10018791m
Common NameCARUB_v10018791mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 229aa    MW: 26507.6 Da    PI: 6.1676
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10018791mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89e-171663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd +l d+v  +G+g+W++I r+ g++R++k+c++rw +yl
  Carubv10018791m 16 KGLWTVEEDNILMDYVLTHGTGQWNRIVRKTGLKRCGKSCRLRWMNYL 63
                     678*******************************************97 PP

2Myb_DNA-binding59.86e-1969114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g +T++E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l
  Carubv10018791m  69 KGTFTEQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNTHL 114
                      799*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.9181163IPR017930Myb domain
SuperFamilySSF466891.24E-3014110IPR009057Homeodomain-like
SMARTSM007175.3E-131565IPR001005SANT/Myb domain
PfamPF002498.0E-151663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-231770IPR009057Homeodomain-like
CDDcd001672.35E-101963No hitNo description
PROSITE profilePS5129428.10864118IPR017930Myb domain
SMARTSM007171.1E-1868116IPR001005SANT/Myb domain
PfamPF002493.7E-1869114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-2771118IPR009057Homeodomain-like
CDDcd001673.42E-1471114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0032880Biological Processregulation of protein localization
GO:0048629Biological Processtrichome patterning
GO:2000039Biological Processregulation of trichome morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MRIRRREERE NQEFKKGLWT VEEDNILMDY VLTHGTGQWN RIVRKTGLKR CGKSCRLRWM  60
NYLSPNVNKG TFTEQEEDLI IRLHKLLGNR WSLIAKRVPG RTDNQVKNYW NTHLSKKLVG  120
DYPSAVKTTG DDEDSQPSLF ITATTTSSLH HQQENIYENL AKSFDNVVSA SYEDKPKPEP  180
DQTDVLVATT NDPSHYYGNN TLWDHEDEFE LSSLVMMNFA SGDIEYCL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-29161187108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195900.0AY519590.1 Arabidopsis thaliana MYB transcription factor (At3g27920) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292555.11e-173hypothetical protein CARUB_v10018791mg
SwissprotP279001e-156GL1_ARATH; Trichome differentiation protein GL1
TrEMBLR0HNH31e-173R0HNH3_9BRAS; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_50005591e-154(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27920.11e-150myb domain protein 0